Lineage for d1hg2a1 (1hg2 A:150-281)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1986092Superfamily a.7.8: GAT-like domain [89009] (3 families) (S)
  5. 1986118Family a.7.8.2: Phosphoinositide-binding clathrin adaptor, domain 2 [100929] (2 proteins)
    this domain is associated with the N-terminal ENTH-like domain
  6. 1986123Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100930] (1 species)
  7. 1986124Species Norway rat (Rattus norvegicus) [TaxId:10116] [100931] (4 PDB entries)
  8. 1986127Domain d1hg2a1: 1hg2 A:150-281 [90358]
    Other proteins in same PDB: d1hg2a2
    complex with inositol(4,5)p2
    complexed with ip2

Details for d1hg2a1

PDB Entry: 1hg2 (more details), 2 Å

PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(4,5)p2 complex
PDB Compounds: (A:) clathrin assembly protein short form

SCOPe Domain Sequences for d1hg2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hg2a1 a.7.8.2 (A:150-281) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafmllfkdairlfa
aynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvgidrgdipdlsq
apsslldaleqh

SCOPe Domain Coordinates for d1hg2a1:

Click to download the PDB-style file with coordinates for d1hg2a1.
(The format of our PDB-style files is described here.)

Timeline for d1hg2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hg2a2