SCOP 1.71: Domain d1hfaa2: 1hfa A:19-149

Lineage for d1hfaa2 (1hfa A:19-149)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (4 families)

5. Family a.118.9.3: Phosphoinositide-binding clathrin adaptor, N-terminal domain [100911] (2 proteins)

6. Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100912] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [100913] (4 PDB entries)

8. Domain d1hfaa2: 1hfa A:19-149 [90357]
   Other proteins in same PDB: d1hfaa1
   complexed with pio

Details for d1hfaa2

PDB Entry: 1hfa, 2 Å

PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, pi(4,5)p2 complex

SCOP Domain Sequences for d1hfaa2:

Sequence; same for both SEQRES and ATOM records:

>d1hfaa2 a.118.9.3 (A:19-149) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus)}
gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks
litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy
rqvafdftkvk

Timeline for d1hfaa2:

• d1hfaa2 first appeared in SCOP 1.67
  
• d1hfaa2 appears in SCOP 1.69
  
• d1hfaa2 appears in SCOP 1.73
  
• d1hfaa2 appears in the current release, SCOPe 2.08