Lineage for d1hfaa1 (1hfa A:150-281)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352565Fold a.7: Spectrin repeat-like [46965] (9 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 352689Superfamily a.7.8: GAT-like domain [89009] (2 families) (S)
  5. 352698Family a.7.8.2: Phosphoinositide-binding clathrin adaptor, domain 2 [100929] (2 proteins)
    this domain is associated with the N-terminal ENTH-like domain
  6. 352703Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100930] (1 species)
  7. 352704Species Rat (Rattus norvegicus) [TaxId:10116] [100931] (4 PDB entries)
  8. 352706Domain d1hfaa1: 1hfa A:150-281 [90356]
    Other proteins in same PDB: d1hfaa2
    complexed with pio

Details for d1hfaa1

PDB Entry: 1hfa (more details), 2 Å

PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, pi(4,5)p2 complex

SCOP Domain Sequences for d1hfaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfaa1 a.7.8.2 (A:150-281) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus)}
rgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafmllfkdairlfa
aynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvgidrgdipdlsq
apsslldaleqh

SCOP Domain Coordinates for d1hfaa1:

Click to download the PDB-style file with coordinates for d1hfaa1.
(The format of our PDB-style files is described here.)

Timeline for d1hfaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hfaa2