SCOP 1.69: Domain d1dsbb_: 1dsb B:

Lineage for d1dsbb_ (1dsb B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.13: DsbA-like [100953] (2 proteins)
   contains an all-alpha subdomain insertion

6. Protein Disulfide-bond formation facilitator (DsbA) [100954] (2 species)
   the insert subdomain is a 4-helical bundle

7. Species Escherichia coli [TaxId:562] [100955] (12 PDB entries)

8. Domain d1dsbb_: 1dsb B: [90348]

Details for d1dsbb_

PDB Entry: 1dsb, 2 Å

PDB Description: crystal structure of the dsba protein required for disulphide bond formation in vivo

SCOP Domain Sequences for d1dsbb_:

Sequence; same for both SEQRES and ATOM records:

>d1dsbb_ c.47.1.13 (B:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

Timeline for d1dsbb_:

• d1dsbb_ first appeared in SCOP 1.67
  
• d1dsbb_ appears in SCOP 1.71
  
• d1dsbb_ appears in the current release, SCOPe 2.08