Lineage for d1dkya1 (1dky A:507-599)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697230Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) (S)
  5. 2697231Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)
  6. 2697235Protein DnaK [100936] (2 species)
  7. 2697236Species Escherichia coli [TaxId:562] [100937] (3 PDB entries)
  8. 2697239Domain d1dkya1: 1dky A:507-599 [90341]
    Other proteins in same PDB: d1dkya2, d1dkyb2

Details for d1dkya1

PDB Entry: 1dky (more details), 2.8 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 2 native crystals
PDB Compounds: (A:) dnak

SCOPe Domain Sequences for d1dkya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkya1 a.8.4.1 (A:507-599) DnaK {Escherichia coli [TaxId: 562]}
lnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaie
saltaletalkgedkaaieakmqelaqvsqklm

SCOPe Domain Coordinates for d1dkya1:

Click to download the PDB-style file with coordinates for d1dkya1.
(The format of our PDB-style files is described here.)

Timeline for d1dkya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dkya2