Lineage for d1dkxa1 (1dkx A:507-607)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439808Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 439871Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family) (S)
  5. 439872Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (1 protein)
  6. 439873Protein DnaK [100936] (2 species)
  7. 439874Species Escherichia coli [TaxId:562] [100937] (3 PDB entries)
  8. 439876Domain d1dkxa1: 1dkx A:507-607 [90339]
    Other proteins in same PDB: d1dkxa2
    complexed with peptide, chain B

Details for d1dkxa1

PDB Entry: 1dkx (more details), 2 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 selenomethionyl crystals

SCOP Domain Sequences for d1dkxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkxa1 a.8.4.1 (A:507-607) DnaK {Escherichia coli}
lnedeiqkmvrdaeanaeadrkfdelvqtrnqgdhllhstrkqveeagdklpaddktaie
saltaletalkgedkaaieakmqelaqvsqklmeiaqqqha

SCOP Domain Coordinates for d1dkxa1:

Click to download the PDB-style file with coordinates for d1dkxa1.
(The format of our PDB-style files is described here.)

Timeline for d1dkxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dkxa2