SCOP 1.67: Domain d1acva_: 1acv A:

Lineage for d1acva_ (1acv A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.13: DsbA-like [100953] (2 proteins)
   contains an all-alpha subdomain insertion

6. Protein Disulfide-bond formation facilitator (DsbA) [100954] (2 species)
   the insert subdomain is a 4-helical bundle

7. Species Escherichia coli [TaxId:562] [100955] (12 PDB entries)

8. Domain d1acva_: 1acv A: [90328]

Details for d1acva_

PDB Entry: 1acv, 1.9 Å

PDB Description: dsba mutant h32s

SCOP Domain Sequences for d1acva_:

Sequence; same for both SEQRES and ATOM records:

>d1acva_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli}
aqyedgkqyttlekpvagapqvleffsffcpscyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

Timeline for d1acva_:

• d1acva_ is new in SCOP 1.67
  
• d1acva_ appears in SCOP 1.69
  
• d1acva_ appears in the current release, SCOPe 2.08