SCOP 1.69: Domain d1a23__: 1a23 -

Lineage for d1a23__ (1a23 -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.13: DsbA-like [100953] (2 proteins)
   contains an all-alpha subdomain insertion

6. Protein Disulfide-bond formation facilitator (DsbA) [100954] (2 species)
   the insert subdomain is a 4-helical bundle

7. Species Escherichia coli [TaxId:562] [100955] (12 PDB entries)

8. Domain d1a23__: 1a23 - [90319]

Details for d1a23__

PDB Entry: 1a23

PDB Description: solution nmr structure of reduced dsba from escherichia coli, minimized average structure

SCOP Domain Sequences for d1a23__:

Sequence; same for both SEQRES and ATOM records:

>d1a23__ c.47.1.13 (-) Disulfide-bond formation facilitator (DsbA) {Escherichia coli}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsekk

Timeline for d1a23__:

• d1a23__ first appeared in SCOP 1.67
  
• d1a23__ appears in SCOP 1.71
  
• d1a23__ appears in the current release, SCOPe 2.08, called d1a23a_