| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
| Domain d2f5al2: 2f5a L:108-213 [88505] Other proteins in same PDB: d2f5ah1, d2f5ah2, d2f5al1 part of HIV-1 neutralizing Fab 2F5 |
PDB Entry: 2f5a (more details), 2.05 Å
SCOPe Domain Sequences for d2f5al2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5al2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyecevthqglsspvtksfnrge
Timeline for d2f5al2: