SCOP 1.69: Domain d2f5ah2: 2f5a H:133-232

Lineage for d2f5ah2 (2f5a H:133-232)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2f5ah2: 2f5a H:133-232 [88503]
   Other proteins in same PDB: d2f5ah1, d2f5al1, d2f5al2
   part of HIV-1 neutralizing Fab 2F5

Details for d2f5ah2

PDB Entry: 2f5a, 2.05 Å

PDB Description: crystal structure of fab' from the hiv-1 neutralizing antibody 2f5

SCOP Domain Sequences for d2f5ah2:

Sequence, based on SEQRES records:

>d2f5ah2 b.1.1.2 (H:133-232) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records):

>d2f5ah2 b.1.1.2 (H:133-232) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtytcnvnhkpsntkvdkrvep

Timeline for d2f5ah2:

• d2f5ah2 first appeared in SCOP 1.65
  
• d2f5ah2 appears in SCOP 1.67
  
• d2f5ah2 appears in SCOP 1.71
  
• d2f5ah2 appears in the current release, SCOPe 2.08