Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Bacterial alpha-amylase [51447] (10 species) |
Species Bacillus sp., ksm-k38 [TaxId:1409] [89463] (6 PDB entries) |
Domain d1ud6a2: 1ud6 A:1-390 [88478] Other proteins in same PDB: d1ud6a1 complexed with k |
PDB Entry: 1ud6 (more details), 2.5 Å
SCOPe Domain Sequences for d1ud6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud6a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} dglngtmmqyyewhlendgqhwnrlhddaaalsdagitaiwippaykgnsqadvgygayd lydlgefnqkgtvrtkygtkaqleraigslksndinvygdvvmnhkmgadfteavqavqv nptnrwqdisgaytidawtgfdfsgrnnaysdfkwrwfhfngvdwdqryqenhifrfant nwnwrvdeengnydyllgsnidfshpevqdelkdwgswftdeldldgyrldaikhipfwy tsdwvrhqrneadqdlfvvgeywkddvgalefyldemnwemslfdvplnynfyrasqqgg sydmrnilrgslveahpmhavtfvdnhdtqpgesleswvadwfkplayatiltreggypn vfygdyygipndnisakkdmidelldarqn
Timeline for d1ud6a2: