Lineage for d1ud5a2 (1ud5 A:1-390)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339388Protein Bacterial alpha-amylase [51447] (10 species)
  7. 1339403Species Bacillus sp., ksm-k38 [TaxId:1409] [89463] (6 PDB entries)
  8. 1339408Domain d1ud5a2: 1ud5 A:1-390 [88476]
    Other proteins in same PDB: d1ud5a1
    complexed with na, rb

Details for d1ud5a2

PDB Entry: 1ud5 (more details), 2.7 Å

PDB Description: Crystal structure of AmyK38 with rubidium ion
PDB Compounds: (A:) amylase

SCOPe Domain Sequences for d1ud5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud5a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]}
dglngtmmqyyewhlendgqhwnrlhddaaalsdagitaiwippaykgnsqadvgygayd
lydlgefnqkgtvrtkygtkaqleraigslksndinvygdvvmnhkmgadfteavqavqv
nptnrwqdisgaytidawtgfdfsgrnnaysdfkwrwfhfngvdwdqryqenhifrfant
nwnwrvdeengnydyllgsnidfshpevqdelkdwgswftdeldldgyrldaikhipfwy
tsdwvrhqrneadqdlfvvgeywkddvgalefyldemnwemslfdvplnynfyrasqqgg
sydmrnilrgslveahpmhavtfvdnhdtqpgesleswvadwfkplayatiltreggypn
vfygdyygipndnisakkdmidelldarqn

SCOPe Domain Coordinates for d1ud5a2:

Click to download the PDB-style file with coordinates for d1ud5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ud5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ud5a1