SCOP 1.71: Domain d1ud5a1: 1ud5 A:391-480

Lineage for d1ud5a1 (1ud5 A:391-480)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (7 species)

7. Species Bacillus sp., ksm-k38 [TaxId:1409] [89382] (6 PDB entries)

8. Domain d1ud5a1: 1ud5 A:391-480 [88475]
   Other proteins in same PDB: d1ud5a2
   complexed with na, rb

Details for d1ud5a1

PDB Entry: 1ud5, 2.7 Å

PDB Description: Crystal structure of AmyK38 with rubidium ion

SCOP Domain Sequences for d1ud5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ud5a1 b.71.1.1 (A:391-480) Bacterial alpha-Amylase {Bacillus sp., ksm-k38}
yaygtqhdyfdhwdvvgwtregsssrpnsglatimsngpggskwmyvgrqnagqtwtdlt
gnngasvtingdgwgefftnggsvsvyvnq

Timeline for d1ud5a1:

• d1ud5a1 first appeared in SCOP 1.65
  
• d1ud5a1 appears in SCOP 1.69
  
• d1ud5a1 appears in SCOP 1.73
  
• d1ud5a1 appears in the current release, SCOPe 2.08