Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Bacterial alpha-Amylase [51013] (9 species) |
Species Bacillus sp., ksm-k38 [TaxId:1409] [89382] (6 PDB entries) |
Domain d1ud4a1: 1ud4 A:391-480 [88473] Other proteins in same PDB: d1ud4a2 complexed with na |
PDB Entry: 1ud4 (more details), 2.15 Å
SCOPe Domain Sequences for d1ud4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud4a1 b.71.1.1 (A:391-480) Bacterial alpha-Amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} yaygtqhdyfdhwdvvgwtregsssrpnsglatimsngpggskwmyvgrqnagqtwtdlt gnngasvtingdgwgefftnggsvsvyvnq
Timeline for d1ud4a1: