Lineage for d1ud3a1 (1ud3 A:391-480)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328006Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 1328025Species Bacillus sp., ksm-k38 [TaxId:1409] [89382] (6 PDB entries)
  8. 1328028Domain d1ud3a1: 1ud3 A:391-480 [88471]
    Other proteins in same PDB: d1ud3a2
    complexed with na; mutant

Details for d1ud3a1

PDB Entry: 1ud3 (more details), 2.15 Å

PDB Description: crystal structure of amyk38 n289h mutant
PDB Compounds: (A:) amylase

SCOPe Domain Sequences for d1ud3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud3a1 b.71.1.1 (A:391-480) Bacterial alpha-Amylase {Bacillus sp., ksm-k38 [TaxId: 1409]}
yaygtqhdyfdhwdvvgwtregsssrpnsglatimsngpggskwmyvgrqnagqtwtdlt
gnngasvtingdgwgefftnggsvsvyvnq

SCOPe Domain Coordinates for d1ud3a1:

Click to download the PDB-style file with coordinates for d1ud3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ud3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ud3a2