| Class b: All beta proteins [48724] (126 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families) ![]() |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Bacterial alpha-Amylase [51013] (6 species) |
| Species Bacillus sp., ksm-k38 [TaxId:1409] [89382] (6 PDB entries) |
| Domain d1ud2a1: 1ud2 A:391-480 [88469] Other proteins in same PDB: d1ud2a2 complexed with gol, na |
PDB Entry: 1ud2 (more details), 2.13 Å
SCOP Domain Sequences for d1ud2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud2a1 b.71.1.1 (A:391-480) Bacterial alpha-Amylase {Bacillus sp., ksm-k38}
yaygtqhdyfdhwdvvgwtregsssrpnsglatimsngpggskwmyvgrqnagqtwtdlt
gnngasvtingdgwgefftnggsvsvyvnq
Timeline for d1ud2a1: