Lineage for d1uc4g_ (1uc4 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699281Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
    contains irregular N-terminal subdomain
    automatically mapped to Pfam PF02287
  5. 2699282Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins)
  6. 2699283Protein Diol dehydratase, gamma subunit [47150] (2 species)
  7. 2699284Species Klebsiella oxytoca [TaxId:571] [47151] (8 PDB entries)
  8. 2699285Domain d1uc4g_: 1uc4 G: [88453]
    Other proteins in same PDB: d1uc4a_, d1uc4b_, d1uc4e_, d1uc4l_
    complexed with cnc, k, nh4, pgo

Details for d1uc4g_

PDB Entry: 1uc4 (more details), 1.8 Å

PDB Description: structure of diol dehydratase complexed with (s)-1,2-propanediol
PDB Compounds: (G:) diol dehydrase gamma subunit

SCOPe Domain Sequences for d1uc4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc4g_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella oxytoca [TaxId: 571]}
sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
reaatlyverkklkgdd

SCOPe Domain Coordinates for d1uc4g_:

Click to download the PDB-style file with coordinates for d1uc4g_.
(The format of our PDB-style files is described here.)

Timeline for d1uc4g_: