Lineage for d1uc3k_ (1uc3 K:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436822Protein Lamprey globin [46518] (2 species)
  7. 436823Species River lamprey (Lampetra fluviatilis) [88966] (1 PDB entry)
  8. 436834Domain d1uc3k_: 1uc3 K: [88448]

Details for d1uc3k_

PDB Entry: 1uc3 (more details), 2.3 Å

PDB Description: crystal structure of hemoglobin i from river lamprey

SCOP Domain Sequences for d1uc3k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc3k_ a.1.1.2 (K:) Lamprey globin {River lamprey (Lampetra fluviatilis)}
pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d1uc3k_:

Click to download the PDB-style file with coordinates for d1uc3k_.
(The format of our PDB-style files is described here.)

Timeline for d1uc3k_: