Lineage for d1uc3e_ (1uc3 E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632769Protein Lamprey globin [46518] (2 species)
  7. 632770Species Lamprey (Lampetra fluviatilis) [TaxId:7748] [88966] (1 PDB entry)
  8. 632775Domain d1uc3e_: 1uc3 E: [88442]

Details for d1uc3e_

PDB Entry: 1uc3 (more details), 2.3 Å

PDB Description: crystal structure of hemoglobin i from river lamprey
PDB Compounds: (E:) globin

SCOP Domain Sequences for d1uc3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc3e_ a.1.1.2 (E:) Lamprey globin {Lamprey (Lampetra fluviatilis) [TaxId: 7748]}
pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d1uc3e_:

Click to download the PDB-style file with coordinates for d1uc3e_.
(The format of our PDB-style files is described here.)

Timeline for d1uc3e_: