Lineage for d1uc3a_ (1uc3 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531489Protein Lamprey globin [46518] (2 species)
  7. 531490Species River lamprey (Lampetra fluviatilis) [88966] (1 PDB entry)
  8. 531491Domain d1uc3a_: 1uc3 A: [88438]

Details for d1uc3a_

PDB Entry: 1uc3 (more details), 2.3 Å

PDB Description: crystal structure of hemoglobin i from river lamprey

SCOP Domain Sequences for d1uc3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc3a_ a.1.1.2 (A:) Lamprey globin {River lamprey (Lampetra fluviatilis)}
pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d1uc3a_:

Click to download the PDB-style file with coordinates for d1uc3a_.
(The format of our PDB-style files is described here.)

Timeline for d1uc3a_: