![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) ![]() |
![]() | Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins) |
![]() | Protein Transketolase (TK), C-domain [52924] (3 species) two N-terminal domains are PP and Pyr modules of thiamin-binding fold |
![]() | Species Escherichia coli [TaxId:562] [89712] (1 PDB entry) |
![]() | Domain d1qgdb3: 1qgd B:528-663 [88372] Other proteins in same PDB: d1qgda1, d1qgda2, d1qgdb1, d1qgdb2 complexed with ca, so4, tpp |
PDB Entry: 1qgd (more details), 1.9 Å
SCOP Domain Sequences for d1qgdb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgdb3 c.48.1.1 (B:528-663) Transketolase (TK), C-domain {Escherichia coli} rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee fgftvdnvvakakell
Timeline for d1qgdb3: