Lineage for d1qgda3 (1qgd A:528-663)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855607Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1855608Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1855609Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 1855628Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 1855644Species Escherichia coli [TaxId:562] [89712] (4 PDB entries)
  8. 1855651Domain d1qgda3: 1qgd A:528-663 [88369]
    Other proteins in same PDB: d1qgda1, d1qgda2, d1qgdb1, d1qgdb2
    complexed with ca, so4, tpp

Details for d1qgda3

PDB Entry: 1qgd (more details), 1.9 Å

PDB Description: transketolase from escherichia coli
PDB Compounds: (A:) protein (transketolase)

SCOPe Domain Sequences for d1qgda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgda3 c.48.1.1 (A:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell

SCOPe Domain Coordinates for d1qgda3:

Click to download the PDB-style file with coordinates for d1qgda3.
(The format of our PDB-style files is described here.)

Timeline for d1qgda3: