Lineage for d1qgda3 (1qgd A:528-663)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 396644Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 396645Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 396646Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 396653Protein Transketolase (TK), C-domain [52924] (3 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 396669Species Escherichia coli [TaxId:562] [89712] (1 PDB entry)
  8. 396670Domain d1qgda3: 1qgd A:528-663 [88369]
    Other proteins in same PDB: d1qgda1, d1qgda2, d1qgdb1, d1qgdb2

Details for d1qgda3

PDB Entry: 1qgd (more details), 1.9 Å

PDB Description: transketolase from escherichia coli

SCOP Domain Sequences for d1qgda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgda3 c.48.1.1 (A:528-663) Transketolase (TK), C-domain {Escherichia coli}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell

SCOP Domain Coordinates for d1qgda3:

Click to download the PDB-style file with coordinates for d1qgda3.
(The format of our PDB-style files is described here.)

Timeline for d1qgda3: