Lineage for d1pxfa_ (1pxf A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374760Family b.40.4.4: Myf domain [50277] (6 proteins)
  6. 374783Protein Structure-specific tRNA-binding protein TRBP111 [89328] (2 species)
  7. 374789Species Escherichia coli [TaxId:562] [89329] (1 PDB entry)
    YgjH
  8. 374790Domain d1pxfa_: 1pxf A: [88341]

Details for d1pxfa_

PDB Entry: 1pxf (more details), 1.87 Å

PDB Description: Crystal Structure of Trbp111: a Structure Specific tRNA Binding Protein

SCOP Domain Sequences for d1pxfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxfa_ b.40.4.4 (A:) Structure-specific tRNA-binding protein TRBP111 {Escherichia coli}
metvayadfarlemrvgkivevkrhenadklyivqvdvgqktlqtvtslvpyyseeelmg
ktvvvlcnlqkakmrgetsecmllcaetddgsesvlltpermmpagvrvva

SCOP Domain Coordinates for d1pxfa_:

Click to download the PDB-style file with coordinates for d1pxfa_.
(The format of our PDB-style files is described here.)

Timeline for d1pxfa_: