SCOP 1.71: Domain d1px7b1: 1px7 B:77-209

Lineage for d1px7b1 (1px7 B:77-209)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries)

8. Domain d1px7b1: 1px7 B:77-209 [88339]
   Other proteins in same PDB: d1px7a2, d1px7b2
   complexed with ca, gsh, mes; mutant

Details for d1px7b1

PDB Entry: 1px7, 2.03 Å

PDB Description: a folding mutant of human class pi glutathione transferase, created by mutating aspartate 153 of the wild-type protein to glutamate

SCOP Domain Sequences for d1px7b1:

Sequence; same for both SEQRES and ATOM records:

>d1px7b1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfaeynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d1px7b1:

• d1px7b1 first appeared in SCOP 1.65
  
• d1px7b1 appears in SCOP 1.69
  
• d1px7b1 appears in SCOP 1.73
  
• d1px7b1 appears in the current release, SCOPe 2.08