Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Transcription termination factor Rho, ATPase domain [89676] (1 species) |
Species Escherichia coli [TaxId:562] [89677] (5 PDB entries) Uniprot P03002 |
Domain d1pv4d3: 1pv4 D:129-417 [88305] Other proteins in same PDB: d1pv4a1, d1pv4a2, d1pv4b1, d1pv4c1, d1pv4c2, d1pv4d1, d1pv4d2, d1pv4e1, d1pv4e2, d1pv4f1, d1pv4f2 protein/DNA complex |
PDB Entry: 1pv4 (more details), 3 Å
SCOPe Domain Sequences for d1pv4d3:
Sequence, based on SEQRES records: (download)
>d1pv4d3 c.37.1.11 (D:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} nkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmll qniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemvie kakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnve eggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrke ellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
>d1pv4d3 c.37.1.11 (D:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} nkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqnia qsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakr lvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnveeggslti iatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqe elqkmwilrkiihpmgeidameflinklamtktnddffemmk
Timeline for d1pv4d3: