Lineage for d1pqsa_ (1pqs A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403055Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 1403071Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 1403076Protein Cell division control protein 24, CDC24, C-terminal domain [89834] (1 species)
  7. 1403077Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89835] (3 PDB entries)
  8. 1403078Domain d1pqsa_: 1pqs A: [88277]
    cloning artifact: lacks the N-terminal strand of the common fold and has a rearranged beta-sheet

Details for d1pqsa_

PDB Entry: 1pqs (more details)

PDB Description: solution structure of the c-terminal opca domain of ycdc24p
PDB Compounds: (A:) Cell division control protein 24

SCOPe Domain Sequences for d1pqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqsa_ d.15.2.2 (A:) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seiftllvekvwnfddlimainskisnthnnnispitkikyqdedgdfvvlgsdedwnva
kemlaennekflnirly

SCOPe Domain Coordinates for d1pqsa_:

Click to download the PDB-style file with coordinates for d1pqsa_.
(The format of our PDB-style files is described here.)

Timeline for d1pqsa_: