SCOPe 2.01: Domain d1pnyx_: 1pny X:

Lineage for d1pnyx_ (1pny X:)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1pnyx_: 1pny X: [88274]
   50S subunit; the coordinates of 30S subunit in 1pnx
   protein/RNA complex

Details for d1pnyx_

PDB Entry: 1pny, 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.

PDB Compounds: (X:) 50S ribosomal protein L30

SCOPe Domain Sequences for d1pnyx_:

Sequence; same for both SEQRES and ATOM records:

>d1pnyx_ i.1.1.1 (X:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe

Timeline for d1pnyx_:

• d1pnyx_ first appeared in SCOP 1.65
  
• d1pnyx_ appears in SCOP 1.75
  
• d1pnyx_ appears in SCOPe 2.02
  
• d1pnyx_ appears in the current release, SCOPe 2.08