Lineage for d1pnyt_ (1pny T:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1467792Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1467793Protein 70S ribosome functional complex [58121] (9 species)
  7. 1467866Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1468154Domain d1pnyt_: 1pny T: [88270]
    50S subunit; the coordinates of 30S subunit in 1pnx
    protein/RNA complex

Details for d1pnyt_

PDB Entry: 1pny (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.
PDB Compounds: (T:) general stress protein ctc

SCOPe Domain Sequences for d1pnyt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnyt_ i.1.1.1 (T:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlp

SCOPe Domain Coordinates for d1pnyt_:

Click to download the PDB-style file with coordinates for d1pnyt_.
(The format of our PDB-style files is described here.)

Timeline for d1pnyt_: