SCOP 1.71: Domain d1pnyl_: 1pny L:

Lineage for d1pnyl_ (1pny L:)

1. Root: SCOP 1.71

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)

8. Domain d1pnyl_: 1pny L: [88262]

Details for d1pnyl_

PDB Entry: 1pny, 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.

SCOP Domain Sequences for d1pnyl_:

Sequence; same for both SEQRES and ATOM records:

>d1pnyl_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv

Timeline for d1pnyl_:

• d1pnyl_ first appeared in SCOP 1.65
  
• d1pnyl_ appears in SCOP 1.69
  
• d1pnyl_ appears in SCOP 1.73
  
• d1pnyl_ appears in the current release, SCOPe 2.08