SCOPe 2.04: Domain d1pnxn_: 1pnx N:

Lineage for d1pnxn_ (1pnx N:)

1. Root: SCOPe 2.04

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1pnxn_: 1pnx N: [88237]
   30S subunit; the coordinates of 50S subunit in 1pny
   protein/RNA complex

Details for d1pnxn_

PDB Entry: 1pnx, 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pnx, contains only molecules of the 30s ribosomal subunit. the 50s subunit is in the pdb file 1pny.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1pnxn_:

Sequence; same for both SEQRES and ATOM records:

>d1pnxn_ i.1.1.1 (N:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1pnxn_:

• d1pnxn_ first appeared in SCOP 1.65
  
• d1pnxn_ appears in SCOPe 2.03
  
• d1pnxn_ appears in SCOPe 2.05
  
• d1pnxn_ appears in the current release, SCOPe 2.08