SCOPe 2.07: Domain d1pnud_: 1pnu D:

Lineage for d1pnud_ (1pnu D:)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1pnud_: 1pnu D: [88201]
   Other proteins in same PDB: d1pnu52
   50S subunit; the coordinates of 30S subunit in 1pns
   protein/RNA complex
   protein/RNA complex

Details for d1pnud_

PDB Entry: 1pnu, 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. this file, 1pnu, contains only molecules of the 50s ribosomal subunit. the 30s subunit, mrna, p-site trna, and a-site trna are in the pdb file 1pns.

PDB Compounds: (D:) 50S ribosomal protein L5

SCOPe Domain Sequences for d1pnud_:

Sequence; same for both SEQRES and ATOM records:

>d1pnud_ i.1.1.1 (D:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
qqlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalit
lqkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpna
fdgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk

Timeline for d1pnud_:

• d1pnud_ first appeared in SCOP 1.65
  
• d1pnud_ appears in SCOPe 2.06
  
• d1pnud_ appears in the current release, SCOPe 2.08