Lineage for d1pnss_ (1pns S:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1069596Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1069808Domain d1pnss_: 1pns S: [88186]
    30S subunit; the coordinates of 50S subunit in 1pnu
    protein/RNA complex

Details for d1pnss_

PDB Entry: 1pns (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pns, contains the 30s subunit, two trnas, and one mrna molecule. the 50s ribosomal subunit is in file 1pnu.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1pnss_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnss_ i.1.1.1 (S:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d1pnss_:

Click to download the PDB-style file with coordinates for d1pnss_.
(The format of our PDB-style files is described here.)

Timeline for d1pnss_: