Lineage for d1pnsp_ (1pns P:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627097Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)
  8. 627122Domain d1pnsp_: 1pns P: [88183]

Details for d1pnsp_

PDB Entry: 1pns (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pns, contains the 30s subunit, two trnas, and one mrna molecule. the 50s ribosomal subunit is in file 1pnu.

SCOP Domain Sequences for d1pnsp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnsp_ i.1.1.1 (P:) 70S ribosome functional complex {Escherichia coli}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1pnsp_:

Click to download the PDB-style file with coordinates for d1pnsp_.
(The format of our PDB-style files is described here.)

Timeline for d1pnsp_: