Lineage for d1pnsb_ (1pns B:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896398Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 896591Domain d1pnsb_: 1pns B: [88169]
    30S subunit; the coordinates of 50S subunit in 1pnu

Details for d1pnsb_

PDB Entry: 1pns (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pns, contains the 30s subunit, two trnas, and one mrna molecule. the 50s ribosomal subunit is in file 1pnu.
PDB Compounds: (B:) 30S ribosomal protein S2

SCOP Domain Sequences for d1pnsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnsb_ i.1.1.1 (B:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOP Domain Coordinates for d1pnsb_:

Click to download the PDB-style file with coordinates for d1pnsb_.
(The format of our PDB-style files is described here.)

Timeline for d1pnsb_: