SCOP 1.75: Domain d1pn8o_: 1pn8 O:

Lineage for d1pn8o_ (1pn8 O:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1pn8o_: 1pn8 O: [88167]
   S12, L11 proteins and E-site tRNA aligned to the cryo-EM map

Details for d1pn8o_

PDB Entry: 1pn8, 10.8 Å

PDB Description: coordinates of s12, l11 proteins and e-site trna from 70s crystal structure separately fitted into the cryo-em map of e.coli 70s.ef-g.gdpnp complex. the atomic coordinates originally from the e-site trna were fitted in the position of the hybrid p/e-site trna.

PDB Compounds: (O:) 30S ribosomal protein S12

SCOP Domain Sequences for d1pn8o_:

Sequence; same for both SEQRES and ATOM records:

>d1pn8o_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

Timeline for d1pn8o_:

• d1pn8o_ first appeared in SCOP 1.65
  
• d1pn8o_ appears in SCOP 1.73
  
• d1pn8o_ appears in SCOPe 2.01
  
• d1pn8o_ appears in the current release, SCOPe 2.08