SCOPe 2.05: Domain d1pn7o_: 1pn7 O:

Lineage for d1pn7o_ (1pn7 O:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1pn7o_: 1pn7 O: [88164]
   S12, L11 proteins and p-tRNA aligned to the cryo-EM map
   protein/RNA complex

Details for d1pn7o_

PDB Entry: 1pn7, 10.8 Å

PDB Description: Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the 70S Cryo-EM map of E.coli ribosome

PDB Compounds: (O:) 30S ribosomal protein S12

SCOPe Domain Sequences for d1pn7o_:

Sequence; same for both SEQRES and ATOM records:

>d1pn7o_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

Timeline for d1pn7o_:

• d1pn7o_ first appeared in SCOP 1.65
  
• d1pn7o_ appears in SCOPe 2.04
  
• d1pn7o_ appears in SCOPe 2.06
  
• d1pn7o_ appears in the current release, SCOPe 2.08