SCOP 1.69: Domain d1pkqg2: 1pkq G:114-213

Lineage for d1pkqg2 (1pkq G:114-213)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1pkqg2: 1pkq G:114-213 [88156]
   Other proteins in same PDB: d1pkqa1, d1pkqa2, d1pkqb1, d1pkqe_, d1pkqf1, d1pkqf2, d1pkqg1, d1pkqj_
   part of humanized Fab 8-18c5

Details for d1pkqg2

PDB Entry: 1pkq, 3 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex

SCOP Domain Sequences for d1pkqg2:

Sequence, based on SEQRES records:

>d1pkqg2 b.1.1.2 (G:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d1pkqg2 b.1.1.2 (G:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1pkqg2:

• d1pkqg2 first appeared in SCOP 1.65
  
• d1pkqg2 appears in SCOP 1.67
  
• d1pkqg2 appears in SCOP 1.71
  
• d1pkqg2 appears in the current release, SCOPe 2.08