Lineage for d1pkqf2 (1pkq F:108-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 656101Domain d1pkqf2: 1pkq F:108-210 [88154]
    Other proteins in same PDB: d1pkqa1, d1pkqb1, d1pkqb2, d1pkqe_, d1pkqf1, d1pkqg1, d1pkqg2, d1pkqj_
    part of humanized Fab 8-18c5

Details for d1pkqf2

PDB Entry: 1pkq (more details), 3 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex
PDB Compounds: (F:) (8-18C5) chimeric Fab, light chain

SCOP Domain Sequences for d1pkqf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkqf2 b.1.1.2 (F:108-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfn

SCOP Domain Coordinates for d1pkqf2:

Click to download the PDB-style file with coordinates for d1pkqf2.
(The format of our PDB-style files is described here.)

Timeline for d1pkqf2: