Lineage for d1pkqe_ (1pkq E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289697Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species)
  7. 1289698Species Norway rat (Rattus norvegicus) [TaxId:10116] [89175] (4 PDB entries)
  8. 1289702Domain d1pkqe_: 1pkq E: [88152]
    Other proteins in same PDB: d1pkqa1, d1pkqa2, d1pkqb1, d1pkqb2, d1pkqf1, d1pkqf2, d1pkqg1, d1pkqg2

Details for d1pkqe_

PDB Entry: 1pkq (more details), 3 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex
PDB Compounds: (E:) Myelin Oligodendrocyte Glycoprotein

SCOPe Domain Sequences for d1pkqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkqe_ b.1.1.1 (E:) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsgqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqd
aeqapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedp
f

SCOPe Domain Coordinates for d1pkqe_:

Click to download the PDB-style file with coordinates for d1pkqe_.
(The format of our PDB-style files is described here.)

Timeline for d1pkqe_: