Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [89175] (4 PDB entries) |
Domain d1pkqe_: 1pkq E: [88152] Other proteins in same PDB: d1pkqa1, d1pkqa2, d1pkqb1, d1pkqb2, d1pkqf1, d1pkqf2, d1pkqg1, d1pkqg2 |
PDB Entry: 1pkq (more details), 3 Å
SCOPe Domain Sequences for d1pkqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkqe_ b.1.1.1 (E:) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]} gsgqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqd aeqapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedp f
Timeline for d1pkqe_: