Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1pkqb2: 1pkq B:114-216 [88151] Other proteins in same PDB: d1pkqa1, d1pkqa2, d1pkqb1, d1pkqe_, d1pkqf1, d1pkqf2, d1pkqg1, d1pkqj_ |
PDB Entry: 1pkq (more details), 3 Å
SCOP Domain Sequences for d1pkqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkqb2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1pkqb2: