Lineage for d1pkoa1 (1pko A:1-125)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023651Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species)
  7. 2023652Species Norway rat (Rattus norvegicus) [TaxId:10116] [89175] (4 PDB entries)
  8. 2023653Domain d1pkoa1: 1pko A:1-125 [88147]
    Other proteins in same PDB: d1pkoa2

Details for d1pkoa1

PDB Entry: 1pko (more details), 1.45 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein (MOG)
PDB Compounds: (A:) Myelin Oligodendrocyte Glycoprotein

SCOPe Domain Sequences for d1pkoa1:

Sequence, based on SEQRES records: (download)

>d1pkoa1 b.1.1.1 (A:1-125) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdae
qapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedpfy
winpg

Sequence, based on observed residues (ATOM records): (download)

>d1pkoa1 b.1.1.1 (A:1-125) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrssrvvhlyrngkdqdaeqa
peyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedpfywi
npg

SCOPe Domain Coordinates for d1pkoa1:

Click to download the PDB-style file with coordinates for d1pkoa1.
(The format of our PDB-style files is described here.)

Timeline for d1pkoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pkoa2