Lineage for d1pjka_ (1pjk A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735376Protein Protein kinase CK2, alpha subunit [56142] (2 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 735377Species Human (Homo sapiens) [TaxId:9606] [75559] (3 PDB entries)
  8. 735379Domain d1pjka_: 1pjk A: [88122]
    complexed with anp, cl; mutant

Details for d1pjka_

PDB Entry: 1pjk (more details), 2.5 Å

PDB Description: Crystal Structure of a C-terminal deletion mutant of human protein kinase CK2 catalytic subunit
PDB Compounds: (A:) casein kinase II, alpha chain

SCOP Domain Sequences for d1pjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjka_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqa

SCOP Domain Coordinates for d1pjka_:

Click to download the PDB-style file with coordinates for d1pjka_.
(The format of our PDB-style files is described here.)

Timeline for d1pjka_: