Lineage for d1piub_ (1piu B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279915Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 280027Protein Ribonucleotide reductase R2 [47257] (6 species)
  7. 280045Species Escherichia coli [TaxId:562] [47258] (13 PDB entries)
  8. 280059Domain d1piub_: 1piu B: [88120]
    complexed with fe, hg, o; mutant

Details for d1piub_

PDB Entry: 1piu (more details), 2.2 Å

PDB Description: oxidized ribonucleotide reductase r2-d84e mutant containing oxo- bridged diferric cluster

SCOP Domain Sequences for d1piub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1piub_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

SCOP Domain Coordinates for d1piub_:

Click to download the PDB-style file with coordinates for d1piub_.
(The format of our PDB-style files is described here.)

Timeline for d1piub_: