Lineage for d1phjb_ (1phj B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668080Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 668089Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)
  7. 668090Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries)
  8. 668101Domain d1phjb_: 1phj B: [88114]
    Other proteins in same PDB: d1phja1, d1phja2, d1phja3
    complexed with 3dr; mutant

Details for d1phjb_

PDB Entry: 1phj (more details), 2.5 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna gg(3dr)gttttgggg
PDB Compounds: (B:) Telomere-binding protein beta subunit

SCOP Domain Sequences for d1phjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phjb_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]}
qqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeavn
efhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqerl
nptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdagi
vkasaskgdefsdfsfkegntatlkiadifvqekg

SCOP Domain Coordinates for d1phjb_:

Click to download the PDB-style file with coordinates for d1phjb_.
(The format of our PDB-style files is described here.)

Timeline for d1phjb_: