SCOP 1.71: Domain d1phjb_: 1phj B:

Lineage for d1phjb_ (1phj B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
   barrel, closed; n=5, S=10

6. Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)

7. Species Oxytricha nova [TaxId:200597] [50276] (13 PDB entries)

8. Domain d1phjb_: 1phj B: [88114]
   Other proteins in same PDB: d1phja1, d1phja2, d1phja3
   complexed with 3dr; mutant

Details for d1phjb_

PDB Entry: 1phj, 2.5 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna gg(3dr)gttttgggg

SCOP Domain Sequences for d1phjb_:

Sequence; same for both SEQRES and ATOM records:

>d1phjb_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova}
qqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeavn
efhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqerl
nptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdagi
vkasaskgdefsdfsfkegntatlkiadifvqekg

Timeline for d1phjb_:

• d1phjb_ first appeared in SCOP 1.65
  
• d1phjb_ appears in SCOP 1.69
  
• d1phjb_ appears in SCOP 1.73
  
• d1phjb_ appears in the current release, SCOPe 2.08