Class b: All beta proteins [48724] (149 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins) barrel, closed; n=5, S=10 |
Protein Core domain of telomere end binding protein beta subunit [50275] (1 species) |
Species Oxytricha nova [TaxId:200597] [50276] (13 PDB entries) |
Domain d1phjb_: 1phj B: [88114] Other proteins in same PDB: d1phja1, d1phja2, d1phja3 complexed with 3dr; mutant |
PDB Entry: 1phj (more details), 2.5 Å
SCOP Domain Sequences for d1phjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1phjb_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova} qqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeavn efhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqerl nptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdagi vkasaskgdefsdfsfkegntatlkiadifvqekg
Timeline for d1phjb_: