SCOP 1.73: Domain d1phja3: 1phj A:329-492

Lineage for d1phja3 (1phj A:329-492)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)

8. Domain d1phja3: 1phj A:329-492 [88113]
   Other proteins in same PDB: d1phjb_
   complexed with 3dr; mutant

Details for d1phja3

PDB Entry: 1phj, 2.5 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna gg(3dr)gttttgggg

PDB Compounds: (A:) Telomere-binding protein alpha subunit

SCOP Domain Sequences for d1phja3:

Sequence, based on SEQRES records:

>d1phja3 b.40.4.3 (A:329-492) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
slnavvltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvk
gydrktkkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvka
dnlhknadarkkledsaelltkfnsyvdavverrngfylikdtk

Sequence, based on observed residues (ATOM records):

>d1phja3 b.40.4.3 (A:329-492) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
slnavvltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvk
gydrktkkssslkkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlh
knadarkkledsaelltkfnsyvdavverrngfylikdtk

Timeline for d1phja3:

• d1phja3 first appeared in SCOP 1.65
  
• d1phja3 appears in SCOP 1.71
  
• d1phja3 appears in SCOP 1.75
  
• d1phja3 appears in the current release, SCOPe 2.08