Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
Protein Telomere end binding protein alpha subunit [50273] (1 species) duplication: consists of three domains of this fold |
Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries) |
Domain d1ph8a1: 1ph8 A:36-204 [88103] Other proteins in same PDB: d1ph8b_ protein/DNA complex; complexed with cl, na |
PDB Entry: 1ph8 (more details), 2.36 Å
SCOPe Domain Sequences for d1ph8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ph8a1 b.40.4.3 (A:36-204) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]} yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys
Timeline for d1ph8a1: