Lineage for d1ph7b_ (1ph7 B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297440Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (9 proteins)
    barrel, closed; n=5, S=10
  6. 297448Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)
  7. 297449Species Oxytricha nova [TaxId:200597] [50276] (13 PDB entries)
  8. 297460Domain d1ph7b_: 1ph7 B: [88102]
    Other proteins in same PDB: d1ph7a1, d1ph7a2, d1ph7a3
    complexed with cl, na; mutant

Details for d1ph7b_

PDB Entry: 1ph7 (more details), 2.9 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttgigg

SCOP Domain Sequences for d1ph7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ph7b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova}
qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav
nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer
lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag
ivkasaskgdefsdfsfkegntatlkiadifvqekg

SCOP Domain Coordinates for d1ph7b_:

Click to download the PDB-style file with coordinates for d1ph7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ph7b_: