SCOP 1.67: Domain d1ph6b_: 1ph6 B:

Lineage for d1ph6b_ (1ph6 B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
   barrel, closed; n=5, S=10

6. Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)

7. Species Oxytricha nova [TaxId:200597] [50276] (13 PDB entries)

8. Domain d1ph6b_: 1ph6 B: [88098]
   Other proteins in same PDB: d1ph6a1, d1ph6a2, d1ph6a3
   complexed with na

Details for d1ph6b_

PDB Entry: 1ph6, 2.1 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttgtgg

SCOP Domain Sequences for d1ph6b_:

Sequence; same for both SEQRES and ATOM records:

>d1ph6b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova}
pqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkea
vnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqe
rlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvda
givkasaskgdefsdfsfkegntatlkiadifvqekg

Timeline for d1ph6b_:

• d1ph6b_ first appeared in SCOP 1.65
  
• d1ph6b_ appears in SCOP 1.69
  
• d1ph6b_ appears in the current release, SCOPe 2.08